PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G231400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 513aa    MW: 55819.1 Da    PI: 6.7988
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G231400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-173582148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed +l+++v+++G g+W+++ +  g+ R++k+c++rw ++l
  Aqcoe1G231400.1.p 35 KGPWTAAEDAILIEYVRKHGEGNWNAVQKNSGLSRCGKSCRLRWANHL 82
                       79******************************************9986 PP

2Myb_DNA-binding49.87.8e-1688131146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g++++eE+ l+++++++lG++ W++ a+ ++ gRt++++k++w++
  Aqcoe1G231400.1.p  88 KGSFSPEEERLILELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 131
                        799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8413082IPR017930Myb domain
SuperFamilySSF466891.17E-3033129IPR009057Homeodomain-like
SMARTSM007176.0E-163484IPR001005SANT/Myb domain
PfamPF002498.9E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-243689IPR009057Homeodomain-like
CDDcd001674.38E-123782No hitNo description
PROSITE profilePS5129425.65183137IPR017930Myb domain
SMARTSM007173.4E-1687135IPR001005SANT/Myb domain
PfamPF002493.9E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2590136IPR009057Homeodomain-like
CDDcd001671.03E-1190131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MMPNSSGAVS DDASSGSGSS HGGGGGGNGS VTLKKGPWTA AEDAILIEYV RKHGEGNWNA  60
VQKNSGLSRC GKSCRLRWAN HLRPNLKKGS FSPEEERLIL ELHAKLGNKW ARMAAQLPGR  120
TDNEIKNYWN TRVKRRQRAG LPLYPQDIQK QASSFHLHQN NHHHQNRPSQ SSSPSMQLTS  180
SQQPKTGFIT PLALFDSMNY STPTSLLSQH NNSYNMNSSI NASIHNLKRF RGGNNVGSFN  240
HYSSRTPTLP SSGSLYTTTN NNNNNNYSSQ LLPAPNFQFD TNGYDFNSQT LLQNCFESNG  300
LMNPGSTFSI KQELPSSQIS QAAANAHASD NKISLAFTRS NSNSGLLEDL LQEAEAMGGR  360
EHARKEGLIQ SQDEKRRELD DFLNNNPPPS GSVFNDKAAT PRLGSGSQWD DSSSNHSSAG  420
VEIKKEATIE MNHSVEDDDL SSLLNILPST MMVSDLYNEG AETSNGQSSV TDEDMGLDMQ  480
HHLPSTSAAA TTSALDNDWT LGVWNNLPGM SC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31331365107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278658.11e-153PREDICTED: uncharacterized protein LOC104612781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-73myb domain protein 101